Review of literature on social networking sites

Utilitiesjournals in ncbi databasesmesh databasencbi handbookncbi help manualncbi news & blogpubmedpubmed central (pmc)pubmed clinical queriespubmed healthall literature resources... Toall how tochemicals & bioassaysdna & rnadata & softwaredomains & structuresgenes & expressiongenetics & medicinegenomes & mapshomologyliteratureproteinssequence analysistaxonomytraining & tutorialsvariationabout ncbi accesskeysmy ncbisign in to ncbisign : abstractformatsummarysummary (text)abstractabstract (text)medlinexmlpmid listapplysend tochoose destinationfileclipboardcollectionse-mailordermy bibliographycitation managerformatsummary (text)abstract (text)medlinexmlpmid listcsvcreate file1 selected item: 28324806formatsummarysummary (text)abstractabstract (text)medlinexmlpmid listmesh and other datae-mailsubjectadditional texte-maildidn't get the message? Epub 2017 mar networking site (sns) use by adolescent mothers: can social support and social capital be enhanced by online social networks?

Literature review on social media advertising

A structured review of the s1, hendricks j2, ferguson s3, towell information1faculty of health university of canberra university dr, bruce act 2617, australia. Education division nursing, midwifery and social science cquniversity australia, level 21, 160 ann street, brisbane, queensland 4000, australia. Electronic address: @ctaims and objectives: to critically appraise the available literature and summarise the evidence relating to adolescent mothers' use of social networking sites in terms of any social support and social capital they may provide and to identify areas for future ound: social networking sites have been demonstrated to provide social support to marginalised individuals and provide psycho-social benefits to members of such groups.

Adolescent mothers are at risk of; social marginalisation; anxiety disorders and depressive symptoms; and poorer health and educational outcomes for their children. Social support has been shown to benefit adolescent mothers thus online mechanisms require : a review of original research articles method: key terms and boolean operators identified research reports across a 20-year timeframe pertaining to the area of enquiry in: cinahl, cochrane library, medline, scopus, eric, proquest, psychinfo, web of science, health collection (informit) and google scholar databases. Eight original research articles met the inclusion criteria for this gs: studies demonstrate that adolescent mothers actively search for health information using the internet and social networking sites, and that social support and social capital can be attributed to their use of specifically created online groups from within targeted health interventions.

Use of a message board forum for pregnant and parenting adolescents also demonstrates elements of social support. There are no studies to date pertaining to adolescent mothers' use of globally accessible social networking sites in terms of social support provision and related sions: further investigation is warranted to explore the potential benefits of adolescent mothers' use of globally accessible social networking sites in terms of any social support provision and social capital they may ght © 2017 elsevier ltd. All rights ds: adolescent mother; social capital; social networking sites; social support; structured review; teenage motherpmid: 28324806 doi: 10.

Indexed for medline] sharepublication type, mesh termspublication typereviewmesh termsadolescentadolescent health servicesfemaleglobal healthhumansmaternal health servicesmidwiferypregnancypregnancy in adolescence/psychology*social marginalization*social networking*social support*linkout - more resourcesfull text sourceselsevier scienceclinicalkey nursingmedicalteenage pregnancy - medlineplus health informationmiscellaneousnci cptac assay portalnci cptc antibody characterization programpubmed commons home. Commentshow to join pubmed commonshow to cite this comment:Ncbi > literature > ncbi web site requires javascript to tionresourcesall resourceschemicals & bioassaysbiosystemspubchem bioassaypubchem compoundpubchem structure searchpubchem substanceall chemicals & bioassays resources... Commentshow to join pubmed commonshow to cite this comment:Ncbi > literature > is currently an issue with the citation download feature.

Learn xplore digital utional sign ence ication, networking & ents, circuits, devices & ing & ered materials, dielectrics & ering , waves & l topics for ics & , energy, & industry cs & control processing & username/ purchased ications sion and & canada: +1 800 678 ide: +1 732 981 crimination y & opting out of cookies.